| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | P-Cadherin |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The P-Cadherin Antibody from Novus Biologicals is a rabbit polyclonal antibody to P-Cadherin. This antibody reacts with human, mouse. The P-Cadherin Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | Synthetic peptides corresponding to P-cadherin (placental)) The peptide sequence was selected from the N terminal of P-cadherin. Peptide sequence AVSENGASVEDPMNISIIVTDQNDHKPKFTQDTFRGSVLEGVLPGTSVMQ. |
|---|
| Other Names | cadherin 3, P-cadherin (placental), cadherin 3, type 1, P-cadherin (placental), cadherin-3, CDHPcalcium-dependent adhesion protein, placental, HJMD, PCADP-cadherin, Placental cadherin |
|---|
| Gene, Accession # | CDH3, Gene ID: 1001, Accession: P22223, SwissProt: P22223 |
|---|
| Catalog # | NBP1-59222 |
|---|
| Price | |
|---|
| Order / More Info | P-Cadherin Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 24332913, 26170146 |
|---|
| 产品资料 |
|
|