| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SLP-76/LCP2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SLP-76/LCP2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SLP-76/LCP2. This antibody reacts with human. The SLP-76/LCP2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human SLP-76/LCP2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: GARFLNLTENDIQKFPKLRVPILSKLSQEINKNEERRSIFTRKPQVPRFPEETESHEEDNGGWSSFEEDDYESPNDDQDGE |
|---|
| Other Names | lymphocyte cytosolic protein 2, lymphocyte cytosolic protein 2 (SH2 domain containing leukocyte protein of76kDa), lymphocyte cytosolic protein 2 (SH2 domain-containing leukocyte protein of76kD), SH2 domain-containing leukocyte protein of 76 kDa, SH2 domain-containing leukocyte protein of 76kD, SLP-76, SLP-76 tyrosine phosphoprotein, SLP7676 kDa tyrosine phosphoprotein |
|---|
| Gene, Accession # | LCP2, Gene ID: 3937 |
|---|
| Catalog # | NBP1-87033 |
|---|
| Price | |
|---|
| Order / More Info | SLP-76/LCP2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|