| Edit |   |
|---|
| Antigenic Specificity | COP9 signalosome complex subunit 2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The COP9 signalosome complex subunit 2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to COP9 signalosome complex subunit 2. This antibody reacts with human. The COP9 signalosome complex subunit 2 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human COP9 signalosome complex subunit 2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ISTSKQNSDFLCQMDLLQEFYETTLEALKDAKNDRLWFKTNTKLGKLYLEREEYGKLQKILRQLHQSCQTDDGEDDLKKGTQLLEIYALEIQMYTAQKNNKKLKALYEQ |
|---|
| Other Names | ALIEN, Alien homolog, COP9 constitutive photomorphogenic homolog subunit 2 (Arabidopsis), COP9 signalosome complex subunit 2, CSN2JAB1-containing signalosome subunit 2, SGN2TR-interacting protein 15, Signalosome subunit 2, thyroid receptor interacting protein 15, Thyroid receptor-interacting protein 15, TRIP15TRIP-15 |
|---|
| Gene, Accession # | COPS2, Gene ID: 9318 |
|---|
| Catalog # | NBP2-58587 |
|---|
| Price | |
|---|
| Order / More Info | COP9 signalosome complex subunit 2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|