| 产品详情 |
| Edit |   |
| Antigenic Specificity | COQ3 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The COQ3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to COQ3. This antibody reacts with human. The COQ3 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human COQ3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KWWDEQGVYAPLHSMNDLRVPFIRDNLLKTIPNHQPGKPLLGMKILDVGCGGGLLTEPLGRLGASVIGIDPV |
| Other Names | 3-demethylubiquinone-10 3-methyltransferase, bA9819.1, coenzyme Q3 homolog, methyltransferase (S. cerevisiae), coenzyme Q3 homolog, methyltransferase (yeast), DHHB methyltransferase, DHHBMT, DHHB-MT, DHHB-MTase, DHHBMTASE, Dihydroxyhexaprenylbenzoate methyltransferase, EC 2.1.1, EC 2.1.1.114, EC 2.1.1.64, hexaprenyldihydroxybenzoate methyltransferase, mitochondrial3,4-dihydroxy-5-hexaprenylbenzoate methyltransferase, methyltransferase COQ3, UG0215E05 |
| Gene, Accession # | COQ3, Gene ID: 51805 |
| Catalog # | NBP1-88725 |
| Price | |
| Order / More Info | COQ3 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|