| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | COQ7 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The COQ7 Antibody from Novus Biologicals is a rabbit polyclonal antibody to COQ7. This antibody reacts with human. The COQ7 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human COQ7 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: AYGRRTSVRFRSSGMTLDNISRAAVDRIIRVDHAGEYGANRIYAGQMAVLGRTSVGPVIQKMWDQEKDHLKKFNELMVTFRVRPTVLMPLWNVLGFA |
|---|
| Other Names | CAT5, CLK1, CLK-1, Coenzyme Q biosynthesis protein 7 homolog, coenzyme Q, 7 (rat, yeast) homolog, coenzyme Q7 homolog, ubiquinone (yeast), COQ7 coenzyme Q, 7 homolog ubiquinone, placental protein KG-20, Timing protein clk-1 homolog, ubiquinone biosynthesis protein COQ7 homolog |
|---|
| Gene, Accession # | COQ7, Gene ID: 10229, Accession: Q99807, SwissProt: Q99807 |
|---|
| Catalog # | NBP2-39084 |
|---|
| Price | |
|---|
| Order / More Info | COQ7 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|