| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PI4KB/PI4KIII beta |
|---|
| Clone | 3B1 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2b kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PI4KB/PI4KIII beta Antibody (3B1) from Novus Biologicals is a mouse monoclonal antibody to PI4KB/PI4KIII beta. This antibody reacts with human. The PI4KB/PI4KIII beta Antibody (3B1) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | PIK4CB (NP_002642.1 731 a.a. - 828 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GGLDGDMFNYYKMLMLQGLIAARKHMDKVVQIVEIMQQGSQLPCFHGSSTIRNLKERFHMSMTEEQLQLLVEQMVDGSMRSITTKLYDGFQYLTNGIM |
|---|
| Other Names | DKFZp686O1820, EC 2.7.1, EC 2.7.1.67, FLJ30129, phosphatidylinositol 4-kinase, catalytic, beta, pi4K92, PI4Kbeta, PI4K-beta, PI4KIIIBETA, type III phosphatidylinositol 4-kinase beta, wortmannin-sensitive |
|---|
| Gene, Accession # | PI4KB, Gene ID: 5298, Accession: NP_002642, SwissProt: NP_002642 |
|---|
| Catalog # | H00005298-M02 |
|---|
| Price | |
|---|
| Order / More Info | PI4KB/PI4KIII beta Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|