| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PIK3C2A |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PIK3C2A Antibody from Novus Biologicals is a rabbit polyclonal antibody to PIK3C2A. This antibody reacts with human. The PIK3C2A Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human PIK3C2A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: CGTKLLYLWTSSHTNSVPGTVTKKGYVMERIVLQVDFPSPAFDIIYTTPQVDRSIIQQHNLETLENDIKGKLLDILHKDSSLGLSKEDK |
|---|
| Other Names | C2-containing phosphatidylinositol kinase, CPK, DKFZp686L193, EC 2.7.1, EC 2.7.1.154, MGC142218, phosphatidylinositol-4-phosphate 3-kinase C2 domain-containing subunit alpha, Phosphoinositide 3-kinase-C2-alpha, phosphoinositide-3-kinase, class 2, alpha polypeptide, PI3-K-C2(ALPHA), PI3-K-C2A, PI3K-C2alpha, PI3K-C2-alpha, PtdIns-3-kinase C2 subunit alpha |
|---|
| Gene, Accession # | PIK3C2A, Gene ID: 5286, Accession: O00443 |
|---|
| Catalog # | NBP1-80908 |
|---|
| Price | |
|---|
| Order / More Info | PIK3C2A Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|