| 产品详情 |
| Edit |   |
| Antigenic Specificity | HNF-3 beta/FoxA2 |
| Clone | 1C7 |
| Host Species | Mouse |
| Reactive Species | human |
| Isotype | IgG2a kappa |
| Format | IgG purified, no preservative |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot, ELISA, Immunocytochemistry/Immunofluorescence, Immunoprecipitation, Immunohistochemistry-Paraffin. Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, IHC-P and ELISA. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The HNF-3 beta/FoxA2 Antibody (1C7) from Novus Biologicals is a mouse monoclonal antibody to HNF-3 beta/FoxA2. This antibody reacts with human. The HNF-3 beta/FoxA2 Antibody (1C7) has been validated for the following applications: Western Blot, ELISA, Immunocytochemistry/Immunofluorescence, Immunoprecipitation, Immunohistochemistry-Paraffin. |
| Immunogen | FOXA2 (NP_068556 363 a.a. - 457 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. HLKPEHHYAFNHPFSINNLMSSEQQHHHSHHHHQPHKMDLKAYEQVMHYPGYGSPMPGSLAMGPVTNKTGLDASPLAADTSYYQGVYSRPIMNSS |
| Other Names | forkhead box A2, Forkhead box protein A2, hepatic nuclear factor-3-beta, hepatocyte nuclear factor 3, beta, hepatocyte nuclear factor 3-beta, HNF-3B, HNF-3-beta, HNF3BTCF-3B, MGC19807, TCF3B, Transcription factor 3B |
| Gene, Accession # | FOXA2, Gene ID: 3170, Accession: NP_068556, SwissProt: NP_068556 |
| Catalog # | H00003170-M10 |
| Price | |
| Order / More Info | HNF-3 beta/FoxA2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|