| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | HNF-3 beta/FoxA2 |
|---|
| Clone | 4G11 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG1 kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Antibody reactivity against recombinant protein for WB. It has been used for IHC-P and ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The HNF-3 beta/FoxA2 Antibody (4G11) from Novus Biologicals is a mouse monoclonal antibody to HNF-3 beta/FoxA2. This antibody reacts with human. The HNF-3 beta/FoxA2 Antibody (4G11) has been validated for the following applications: Western Blot, ELISA, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | FOXA2 (NP_068556 363 a.a. - 457 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. HLKPEHHYAFNHPFSINNLMSSEQQHHHSHHHHQPHKMDLKAYEQVMHYPGYGSPMPGSLAMGPVTNKTGLDASPLAADTSYYQGVYSRPIMNSS |
|---|
| Other Names | forkhead box A2, Forkhead box protein A2, hepatic nuclear factor-3-beta, hepatocyte nuclear factor 3, beta, hepatocyte nuclear factor 3-beta, HNF-3B, HNF-3-beta, HNF3BTCF-3B, MGC19807, TCF3B, Transcription factor 3B |
|---|
| Gene, Accession # | FOXA2, Gene ID: 3170, Accession: NP_068556, SwissProt: NP_068556 |
|---|
| Catalog # | H00003170-M11 |
|---|
| Price | |
|---|
| Order / More Info | HNF-3 beta/FoxA2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|