| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | THRSP |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The THRSP Antibody from Novus Biologicals is a rabbit polyclonal antibody to THRSP. This antibody reacts with human. The THRSP Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human THRSP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: TYFTMLKAICVDVDHGLLPREEWQAKVAGSEENGTAETEEVEDESASGELDLEAQFHLHFSSLHHILMHLTEKAQEVTRKYQEMT |
|---|
| Other Names | lipogenic protein 1, Lpgp, LPGP1, S14MGC21659, Spot 14 protein, SPOT14SPOT14 homolog, thyroid hormone responsive, thyroid hormone responsive (SPOT14 homolog, rat), thyroid hormone responsive SPOT14, thyroid hormone responsive SPOT14 (rat) homolog, thyroid hormone-inducible hepatic protein |
|---|
| Gene, Accession # | THRSP, Gene ID: 7069 |
|---|
| Catalog # | NBP1-81290 |
|---|
| Price | |
|---|
| Order / More Info | THRSP Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|