| Edit |   |
|---|
| Antigenic Specificity | WBP2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The WBP2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to WBP2. This antibody reacts with human. The WBP2 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to WBP2(WW domain binding protein 2) The peptide sequence was selected from the N terminal of WBP2. Peptide sequence MKNVPEAFKGTKKGTVYLTPYRVIFLSKGKDAMQSFMMPFYLMKDCEIKQ. |
|---|
| Other Names | WBP-2MGC18269, WW domain binding protein 2, WW domain-binding protein 2 |
|---|
| Gene, Accession # | WBP2, Gene ID: 23558, Accession: Q969T9, SwissProt: Q969T9 |
|---|
| Catalog # | NBP1-56661 |
|---|
| Price | |
|---|
| Order / More Info | WBP2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|