| Edit |   |
| Antigenic Specificity | WBP4 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The WBP4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to WBP4. This antibody reacts with human. The WBP4 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the N terminal of human WBP4. Peptide sequence: NHKENVAKRISEIKQKSLDKAKEEEKASKEFAAMEAAALKAYQEDLKRLG |
| Other Names | domain-containing binding protein 4, WW domain binding protein 4 (formin binding protein 21) |
| Gene, Accession # | WBP4, Gene ID: 11193, Accession: NP_009118, SwissProt: NP_009118 |
| Catalog # | NBP1-79490-20ul |
| Price | |
| Order / More Info | WBP4 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |