| Edit |   |
|---|
| Antigenic Specificity | WBP4 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The WBP4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to WBP4. This antibody reacts with human. The WBP4 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the N terminal of human WBP4. Peptide sequence: NHKENVAKRISEIKQKSLDKAKEEEKASKEFAAMEAAALKAYQEDLKRLG |
|---|
| Other Names | domain-containing binding protein 4, WW domain binding protein 4 (formin binding protein 21) |
|---|
| Gene, Accession # | WBP4, Gene ID: 11193, Accession: NP_009118, SwissProt: NP_009118 |
|---|
| Catalog # | NBP1-79490 |
|---|
| Price | |
|---|
| Order / More Info | WBP4 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|