| Edit |   |
| Antigenic Specificity | WBSCR16 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The WBSCR16 Antibody from Novus Biologicals is a rabbit polyclonal antibody to WBSCR16. This antibody reacts with human. The WBSCR16 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human WBSCR16 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: TLLSSKTADVTKVWGMGLNKDSQLGFHRSRKDKTRGYEYVLEPSPVSLPLDRPQETRVLQVSCGRAHSLVLTDREGVFSMGNNSYGQCGRKVVEN |
| Other Names | DKFZp434D0421, MGC189739, MGC44931, RCC1-like G exchanging factor-like protein, Williams-Beuren syndrome chromosomal region 16 protein, Williams-Beuren syndrome chromosome region 16 |
| Gene, Accession # | WBSCR16, Gene ID: 81554, Accession: Q96I51, SwissProt: Q96I51 |
| Catalog # | NBP2-31833 |
| Price | |
| Order / More Info | WBSCR16 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |