| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Peroxiredoxin 2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Peroxiredoxin 2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Peroxiredoxin 2. This antibody reacts with human, rat. The Peroxiredoxin 2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | Synthetic peptides corresponding to PRDX2(peroxiredoxin 2) The peptide sequence was selected from the middle region of PRDX2. Peptide sequence VLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGVLKTD. |
|---|
| Other Names | EC 1.11.1, MGC4104, Natural killer cell-enhancing factor B, natural killer-enhancing factor B, NKEFBNKEF-B, peroxiredoxin 2, peroxiredoxin-2, PRPTDPX1, PRX2, PRXII, thiol-specific antioxidant 1, Thiol-specific antioxidant protein, Thioredoxin peroxidase 1, Thioredoxin-dependent peroxide reductase 1, torin, TPX1, TSAEC 1.11.1.15 |
|---|
| Gene, Accession # | PRDX2, Gene ID: 7001, Accession: P35704 |
|---|
| Catalog # | NBP1-54337 |
|---|
| Price | |
|---|
| Order / More Info | Peroxiredoxin 2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|