| 产品详情 |
| Edit |   |
| Antigenic Specificity | CaMKII beta |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 25ul |
| Concentration | n/a |
| Applications | Western Blot, Simple Western, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Use PFA/Triton X-100. WB dilution: 1:100-1:500 (Rodent material) and 1:500-1:1000 (Human material). In Simple Western only 10-15 uL of the recommended dilution is used per data point. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The CaMKII beta Antibody from Novus Biologicals is a rabbit polyclonal antibody to CaMKII beta. This antibody reacts with human, mouse. The CaMKII beta Antibody has been validated for the following applications: Western Blot, Simple Western, Immunohistochemistry, Immunohistochemistry-Paraffin. |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: TRNFSVGRQTTAPATMSTAASGTTMGLVEQAKSLLNKKADGVKPQTNSTKNSAAATSPKGTLPPAALEPQTTVIH |
| Other Names | calcium/calmodulin-dependent protein kinase (CaM kinase) II beta, calcium/calmodulin-dependent protein kinase II beta, calcium/calmodulin-dependent protein kinase type II beta chain, calcium/calmodulin-dependent protein kinase type II subunit beta, CaM kinase II beta subunit, CaM kinase II subunit beta, CAM2CAMK2, CAMKB, CaMK-II subunit beta, CaM-kinase II beta chain, EC 2.7.11, EC 2.7.11.17, MGC29528, proline rich calmodulin-dependent protein kinase |
| Gene, Accession # | CAMK2B, Gene ID: 816 |
| Catalog # | NBP1-88212-25ul |
| Price | |
| Order / More Info | CaMKII beta Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|