| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CaM Kinase II delta |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CaM Kinase II delta Antibody from Novus Biologicals is a rabbit polyclonal antibody to CaM Kinase II delta. This antibody reacts with human. The CaM Kinase II delta Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human CaM Kinase II delta antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MDGSGMPKTMQSEETRVWHRRDGKWQNVHFHRSGSPTVPIKPPCIPNGKENFSGGTSLWQ |
|---|
| Other Names | calcium/calmodulin-dependent protein kinase (CaM kinase) II delta, calcium/calmodulin-dependent protein kinase II delta, calcium/calmodulin-dependent protein kinase type II delta chain, calcium/calmodulin-dependent protein kinase type II subunit delta, CaM kinase II delta subunit, CaM kinase II subunit delta, CAMKD, CaMK-II delta subunit, CaMK-II subunit delta, CaM-kinase II delta chain, DKFZp686G23119, DKFZp686I2288, EC 2.7.11, EC 2.7.11.17, MGC44911 |
|---|
| Gene, Accession # | CAMK2D, Gene ID: 817 |
|---|
| Catalog # | NBP1-88211 |
|---|
| Price | |
|---|
| Order / More Info | CaM Kinase II delta Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|