| 产品详情 |
| Edit |   |
| Antigenic Specificity | CaM Kinase II gamma |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The CaM Kinase II gamma Antibody from Novus Biologicals is a rabbit polyclonal antibody to CaM Kinase II gamma. This antibody reacts with human. The CaM Kinase II gamma Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human CaM Kinase II gamma antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: NSLVSPAQEPAPLQTAMEPQTTVVHNATDGIKGSTESCNTTTEDEDLKAAPLRTGNGSSVPEGRSSR |
| Other Names | calcium/calmodulin-dependent protein kinase (CaM kinase) II gamma, calcium/calmodulin-dependent protein kinase II gamma, calcium/calmodulin-dependent protein kinase type II subunit gamma, CaM kinase II subunit gamma, CAMK, CAMKGFLJ16043, CAMK-II, CaMK-II subunit gamma, EC 2.7.11, EC 2.7.11.17, MGC26678 |
| Gene, Accession # | CAMK2G, Gene ID: 818 |
| Catalog # | NBP2-57797 |
| Price | |
| Order / More Info | CaM Kinase II gamma Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|