| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Collagen II |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Collagen II Antibody from Novus Biologicals is a rabbit polyclonal antibody to Collagen II. This antibody reacts with human. The Collagen II Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human Collagen II antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PGPGIDMSAFAGLGPREKGPDPLQYMRADQAAGGLRQHDAEVDATL |
|---|
| Other Names | Alpha-1 type II collagen, ANFH, AOM, cartilage collagen, chondrocalcin, COL11A3, Collagen 2, collagen alpha-1(II) chain, collagen II, alpha-1 polypeptide, collagen type 2, collagen, type II, alpha 1, collagen, type II, alpha 1 (primary osteoarthritis, spondyloepiphysealdysplasia, congenital), Collagen-2, MGC131516, SEDC |
|---|
| Gene, Accession # | COL2A1, Gene ID: 1280 |
|---|
| Catalog # | NBP2-55511 |
|---|
| Price | |
|---|
| Order / More Info | Collagen II Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|