| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | TRNT1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 25ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Simple Western, Immunohistochemistry, Immunohistochemistry-Paraffin, Knockdown Validated. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TRNT1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TRNT1. This antibody reacts with human, rat. The TRNT1 Antibody has been validated for the following applications: Western Blot, Simple Western, Immunohistochemistry, Immunohistochemistry-Paraffin, Knockdown Validated. |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LDLRLKIAKEEKNLGLFIVKNRKDLIKATDSSDPLKPYQDFIIDSREPDATTRVCELLKYQGEHCLLKEMQQWSIPPFPVSGHDIR |
|---|
| Other Names | CCA1, CCA-adding, CGI-47, EC 2.7.7.72, mitochondrial CCA-adding tRNA-nucleotidyltransferase, mt CCA-adding enzyme, mt tRNA adenylyltransferase, mt tRNA CCA-diphosphorylase, mt tRNA CCA-pyrophosphorylase, MtCCA, tRNA nucleotidyl transferase, CCA-adding, 1, tRNA-nucleotidyltransferase 1, mitochondrial |
|---|
| Gene, Accession # | TRNT1, Gene ID: 51095, Accession: Q96Q11, SwissProt: Q96Q11 |
|---|
| Catalog # | NBP1-86589-25ul |
|---|
| Price | |
|---|
| Order / More Info | TRNT1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 23435261, 26494905 |
|---|
| 产品资料 |
|
|