| Edit |   |
| Antigenic Specificity | CRB3 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. ICC/IF reported in scientific literature (PMID: 26493500). For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The CRB3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CRB3. This antibody reacts with human, mouse. The CRB3 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human CRB3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: VRKLREKRQTEGTYRPSSEEQFSHAAEARAPQDSKETVQGCLPI |
| Other Names | crumbs 3, crumbs homolog 3 (Drosophila), crumbs protein homolog 3, MGC17303 |
| Gene, Accession # | CRB3, Gene ID: 92359, Accession: Q9BUF7 |
| Catalog # | NBP1-81185 |
| Price | |
| Order / More Info | CRB3 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 26493500, 29155075 |