| 产品详情 |
| Edit |   |
| Antigenic Specificity | FFAR4/GPR120 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The FFAR4/GPR120 Antibody from Novus Biologicals is a rabbit polyclonal antibody to FFAR4/GPR120. This antibody reacts with human. The FFAR4/GPR120 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human FFAR4/GPR120 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: FRVVPQRLPGADQEISICTLIWPTIPGEISWDV |
| Other Names | G protein-coupled receptor 120, G protein-coupled receptor 129, G protein-coupled receptor PGR4, GPR120, GPR129, G-protein coupled receptor 120, G-protein coupled receptor 129, G-protein coupled receptor GT01, G-protein coupled receptor PGR4, G-protein-coupled receptor GT01, GT01, MGC119984, omega-3 fatty acid receptor 1, PGR4DKFZp686F0824 |
| Gene, Accession # | FFAR4, Gene ID: 338557, Accession: Q5NUL3, SwissProt: Q5NUL3 |
| Catalog # | NBP1-89739 |
| Price | |
| Order / More Info | FFAR4/GPR120 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|