| 产品详情 |
| Edit |   |
| Antigenic Specificity | O-GlcNAc Transferase p110 subunit |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The O-GlcNAc Transferase p110 subunit Antibody from Novus Biologicals is a rabbit polyclonal antibody to O-GlcNAc Transferase p110 subunit. This antibody reacts with human. The O-GlcNAc Transferase p110 subunit Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence. |
| Immunogen | Synthetic peptides corresponding to OGT(O-linked N-acetylglucosamine (GlcNAc) transferase) The peptide sequence was selected from the N terminal of OGT. Peptide sequence ASSVGNVADSTEPTKRMLSFQGLAELAHREYQAGDFEAAERHCMQLWRQE. |
| Other Names | EC 2.4.1, EC 2.4.1.255, FLJ23071, HRNT1, MGC22921, O-GLCNAC, O-GlcNAc transferase p110 subunit, O-GlcNAc transferase subunit p110, O-linked N-acetylglucosamine (GlcNAc) transferase(UDP-N-acetylglucosamine:polypeptide-N-acetylglucosaminyl transferase), O-linked N-acetylglucosamine transferase 110 kDa subunit, UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDasubunit, uridinediphospho-N-acetylglucosamine:polypeptide beta-N-acetylglucosaminyltransferase |
| Gene, Accession # | OGT, Gene ID: 8473, Accession: O15294, SwissProt: O15294 |
| Catalog # | NBP1-52925 |
| Price | |
| Order / More Info | O-GlcNAc Transferase p110 subunit Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|