| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | OIP5 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 25ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The OIP5 Antibody from Novus Biologicals is a rabbit polyclonal antibody to OIP5. This antibody reacts with human. The OIP5 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: CGSCGIPVGFHLYSTHAALAALRGHFCLSSDKMVCYLLKTKAIVNASEMD IQNVPLSEKIAELKEKIVLTHNRLKSLMKILSEVT |
|---|
| Other Names | Cancer/testis antigen 86, CT865730547N13Rik, hMIS18beta, LAP2alpha interactor-25, LINT-25, MIS18B, MIS18beta, OIP-5, Opa interacting protein 5, Opa-interacting protein 5, protein Mis18-beta |
|---|
| Gene, Accession # | OIP5, Gene ID: 11339 |
|---|
| Catalog # | NBP2-13688-25ul |
|---|
| Price | |
|---|
| Order / More Info | OIP5 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|