| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PFKFB2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PFKFB2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PFKFB2. This antibody reacts with human. The PFKFB2 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human PFKFB2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: RDKPTNNFPKNQTPVRMRRNSFTPLSSSNTIRRPRNYSVGSRPLKPLSPLRAQDMQEG |
|---|
| Other Names | 6PF-2-K/Fru-2,6-P2ase 2, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 2, 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2, DKFZp781D2217, fructose-2,6-bisphosphatase, cardiac isozyme, MGC138308,6PF-2-K/Fru-2,6-P2ase heart-type isozyme, MGC138310, PFK/FBPase 2, PFK-2/FBPase-2, PFKFB, cardiac |
|---|
| Gene, Accession # | PFKFB2, Gene ID: 5208, Accession: O60825, SwissProt: O60825 |
|---|
| Catalog # | NBP2-33584 |
|---|
| Price | |
|---|
| Order / More Info | PFKFB2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|