| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Olfactomedin-1/Noelin-1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Olfactomedin-1/Noelin-1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Olfactomedin-1/Noelin-1. This antibody reacts with human. The Olfactomedin-1/Noelin-1 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human Olfactomedin-1/Noelin-1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: IEVLDRRTQRDLQYVEKMENQMKGLESKFKQVEESHKQHLARQFKAIKAKMDE |
|---|
| Other Names | AMYolfactomedin related ER localized protein, neuroblastoma protein, Neuronal olfactomedin-related ER localized protein, NOE1noelin, NOEL1, NOELIN, NOELIN1, OlfA, olfactomedin 1, olfactomedin-1, pancortin 1 |
|---|
| Gene, Accession # | OLFM1, Gene ID: 10439, Accession: Q99784, SwissProt: Q99784 |
|---|
| Catalog # | NBP2-33836 |
|---|
| Price | |
|---|
| Order / More Info | Olfactomedin-1/Noelin-1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|