| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Helios |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Helios Antibody from Novus Biologicals is a rabbit polyclonal antibody to Helios. This antibody reacts with human. The Helios Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human Helios antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: CLDSTDSESSHDDHQSYQGHPALNPKRKQSPAYMKEDVKALDTTKAPKGSLKDIYKVFNGEGEQIR |
|---|
| Other Names | HELIOS, IKAROS family zinc finger 2 (Helios), Ikaros family zinc finger protein 2, MGC34330, subfamily 1A, 2 (Helios), zinc finger DNA binding protein Helios, zinc finger protein Helios, ZNF1A2, ZNFN1A2 |
|---|
| Gene, Accession # | IKZF2, Gene ID: 22807, Accession: Q9UKS7, SwissProt: Q9UKS7 |
|---|
| Catalog # | NBP2-34122 |
|---|
| Price | |
|---|
| Order / More Info | Helios Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|