| Edit |   |
| Antigenic Specificity | HEM1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The HEM1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to HEM1. This antibody reacts with human. The HEM1 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the N terminal of human NCKAP1L. Peptide sequence CSDPKSKPPFLLEKSMEPSLKYINKKFPNIDVRNSTQHLGPVHREKAEII. |
| Other Names | Hematopoietic protein 1HEM1Membrane-associated protein HEM-1, NCK-associated protein 1-like |
| Gene, Accession # | NCKAP1L, Gene ID: 3071, Accession: NP_005328, SwissProt: NP_005328 |
| Catalog # | NBP1-79230-20ul |
| Price | |
| Order / More Info | HEM1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |