| Edit |   |
|---|
| Antigenic Specificity | HEM1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The HEM1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to HEM1. This antibody reacts with human. The HEM1 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the C terminal of human NCKAP1L. Peptide sequence LPLLATDPSSFYSIEKDGYNNNIHCLTKAIIQVSAALFTLYNKNIETHLK. |
|---|
| Other Names | Hematopoietic protein 1HEM1Membrane-associated protein HEM-1, NCK-associated protein 1-like |
|---|
| Gene, Accession # | NCKAP1L, Gene ID: 3071, Accession: NP_005328, SwissProt: NP_005328 |
|---|
| Catalog # | NBP1-79231 |
|---|
| Price | |
|---|
| Order / More Info | HEM1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|