| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Hematopoietic Prostaglandin D Synthase/HPGDS |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Hematopoietic Prostaglandin D Synthase/HPGDS Antibody from Novus Biologicals is a rabbit polyclonal antibody to Hematopoietic Prostaglandin D Synthase/HPGDS. This antibody reacts with human. The Hematopoietic Prostaglandin D Synthase/HPGDS Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Hematopoietic Prostaglandin D Synthase/HPGDS antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWI |
|---|
| Other Names | EC 2.5.1.18, EC 5.3.99.2, Glutathione S-transferase, glutathione S-transferase sigma, Glutathione-dependent PGD synthase, Glutathione-requiring prostaglandin D synthase, GST class-sigma, GSTShematopoietic prostaglandin D2 synthase, hematopoietic prostaglandin D synthase, H-PGDS, PGDSglutathione-dependent PGD synthetase, Prostaglandin-H2 D-isomerase, PTGDS2 |
|---|
| Gene, Accession # | HPGDS, Gene ID: 27306 |
|---|
| Catalog # | NBP1-83322 |
|---|
| Price | |
|---|
| Order / More Info | Hematopoietic Prostaglandin D Synthase/HPGDS Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|