| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Hematopoietic Prostaglandin D Synthase/HPGDS |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Hematopoietic Prostaglandin D Synthase/HPGDS Antibody from Novus Biologicals is a rabbit polyclonal antibody to Hematopoietic Prostaglandin D Synthase/HPGDS. This antibody reacts with human. The Hematopoietic Prostaglandin D Synthase/HPGDS Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | Synthetic peptides corresponding to PGDS(prostaglandin D2 synthase, hematopoietic) The peptide sequence was selected from the N terminal of PGDS. Peptide sequence EQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEME. |
|---|
| Other Names | EC 2.5.1.18, EC 5.3.99.2, Glutathione S-transferase, glutathione S-transferase sigma, Glutathione-dependent PGD synthase, Glutathione-requiring prostaglandin D synthase, GST class-sigma, GSTShematopoietic prostaglandin D2 synthase, hematopoietic prostaglandin D synthase, H-PGDS, PGDSglutathione-dependent PGD synthetase, Prostaglandin-H2 D-isomerase, PTGDS2 |
|---|
| Gene, Accession # | HPGDS, Gene ID: 27306, Accession: O60760, SwissProt: O60760 |
|---|
| Catalog # | NBP1-54625 |
|---|
| Price | |
|---|
| Order / More Info | Hematopoietic Prostaglandin D Synthase/HPGDS Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|