| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Transglutaminase 1/TGM1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Transglutaminase 1/TGM1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Transglutaminase 1/TGM1. This antibody reacts with human. The Transglutaminase 1/TGM1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Transglutaminase 1/TGM1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: MMDGPRSDVGRWGGNPLQPPTTPSPEPEPEPDGRSRRGGGRSFWARCCGCCSCRNAADDDWGPEPSDSRGRGSSSGTRRPGSRGSDSRRPVSRGSGVNAA |
|---|
| Other Names | Epidermal TGase, ICR2, KTG, LI, LI1EC 2.3.2.13, protein-glutamine gamma-glutamyltransferase K, protein-glutamine-gamma-glutamyltransferase), TG(K), TGASE, TGase-1, TGKTGase K, transglutaminase 1 (K polypeptide epidermal type I, Transglutaminase K, transglutaminase, keratinocyte, transglutaminase-1 |
|---|
| Gene, Accession # | TGM1, Gene ID: 7051, Accession: P22735, SwissProt: P22735 |
|---|
| Catalog # | NBP2-34062 |
|---|
| Price | |
|---|
| Order / More Info | Transglutaminase 1/TGM1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|