| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SON |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SON Antibody from Novus Biologicals is a rabbit polyclonal antibody to SON. This antibody reacts with human. The SON Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human SON antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PVAKVLEPSETLVVSSETPTEVYPEPSTSTTMDFPESSAIEALRLPEQPVDVPSEIADSSMTRPQELPELPKTTALE |
|---|
| Other Names | BASS1C21orf50, Bax antagonist selected in saccharomyces 1, DBP5, DBP-5, FLJ33914, KIAA1019SON3, Negative regulatory element-binding protein, NREBPNRE-binding protein, Protein DBP-5, protein SON, SON DNA binding protein, SON DNA-binding protein, KIAA101910FLJ21099 |
|---|
| Gene, Accession # | SON, Gene ID: 6651 |
|---|
| Catalog # | NBP2-55412 |
|---|
| Price | |
|---|
| Order / More Info | SON Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|