| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ACSM1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval method is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ACSM1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ACSM1. This antibody reacts with human. The ACSM1 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human ACSM1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: HHLPQFDTKVIIQTLLKYPINHFWGVSSIYRMILQQDFTSIRFPALEHCYTGGEVVLPKDQEEWKRRTG |
|---|
| Other Names | acyl-CoA synthetase medium-chain family member 1EC 6.2.1.2, acyl-coenzyme A synthetase ACSM1, mitochondrial, BUCS1, Butyrate CoA ligase, Butyrate--CoA ligase 1, butyryl Coenzyme A synthetase 1, Butyryl-coenzyme A synthetase 1, EC 6.2.1, LAE, Lipoate-activating enzyme, MACS1MGC150532, medium-chain acyl-CoA synthetase, Middle-chain acyl-CoA synthetase 1 |
|---|
| Gene, Accession # | ACSM1, Gene ID: 116285, Accession: Q08AH1, SwissProt: Q08AH1 |
|---|
| Catalog # | NBP1-91645 |
|---|
| Price | |
|---|
| Order / More Info | ACSM1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|