| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Protein Disulfide Isomerase/P4HB |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Protein Disulfide Isomerase/P4HB Antibody from Novus Biologicals is a rabbit polyclonal antibody to Protein Disulfide Isomerase/P4HB. This antibody reacts with human. The Protein Disulfide Isomerase/P4HB Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | Synthetic peptides corresponding to P4HB(procollagen-proline, 2-oxoglutarate 4-dioxygenase, beta polypeptide) The peptide sequence was selected from the N terminal of P4HB. Peptide sequence TIKFFRNGDTASPKEYTAGREADDIVNWLKKRTGPAATTLPDGAAAESL |
|---|
| Other Names | Cellular thyroid hormone-binding protein, collagen prolyl 4-hydroxylase beta, DSI, ERBA2L, GIT, glutathione-insulin transhydrogenase, P4Hbeta, p55, PDIA1procollagen-proline, 2-oxoglutarate 4-dioxygenase (proline 4-hydroxylase), betapolypeptide (protein disulfide isomerase-associated 1), PDIEC 5.3.4.1, PHDB, PO4DB, PO4HB, procollagen-proline, 2-oxoglutarate 4-dioxygenase (proline 4-hydroxylase), betapolypeptide, PROHBprocollagen-proline, 2-oxoglutarate 4-dioxygenase (proline 4-hydroxylase), betapolypeptide (protein disulfide isomerase; thyroid hormone binding protein p55), Prolyl 4-hydroxylase subunit beta, prolyl 4-hydroxylase, beta polypeptide, protein disulfide isomerase family A, member 1, protein disulfide isomerase/oxidoreductase, protein disulfide isomerase-associated 1, protein disulfide-isomerase, protocollagen hydroxylase, thyroid hormone-binding protein p55 |
|---|
| Gene, Accession # | P4HB, Gene ID: 5034, Accession: P07237, SwissProt: P07237 |
|---|
| Catalog # | NBP1-57949 |
|---|
| Price | |
|---|
| Order / More Info | Protein Disulfide Isomerase/P4HB Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|