| Edit |   |
|---|
| Antigenic Specificity | Synaptogyrin 3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunoprecipitation, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. IP reported in a verified customer review. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Synaptogyrin 3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Synaptogyrin 3. This antibody reacts with human. The Synaptogyrin 3 Antibody has been validated for the following applications: Immunohistochemistry, Immunoprecipitation, Immunohistochemistry-Paraffin. Specificity of human Synaptogyrin 3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: KALQRFRLGTDMSLFATEQLSTGASQAYPGYPVGSGVEGTETYQSPPFTETLDTSPKGYQVP |
|---|
| Other Names | MGC20003, synaptogyrin 3, synaptogyrin-3 |
|---|
| Gene, Accession # | SYNGR3, Gene ID: 9143, Accession: O43761, SwissProt: O43761 |
|---|
| Catalog # | NBP2-30475 |
|---|
| Price | |
|---|
| Order / More Info | Synaptogyrin 3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 29398363 |
|---|