| Edit |   |
|---|
| Antigenic Specificity | DEP Domain Containing 5 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The DEP Domain Containing 5 Antibody from Novus Biologicals is a rabbit polyclonal antibody to DEP Domain Containing 5. This antibody reacts with human. The DEP Domain Containing 5 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human DEP Domain Containing 5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: GIGVDLVCVGEQPLHAVPLFKLHNRSAPRDSRLGDDYNIPHWINHSFYTSKSQLFCNSFTPRIKLAGKKPASEKAKNGRDTSLGSPK |
|---|
| Other Names | DEP Domain-Containing Protein 5, DEP.5, DEPDC5, FFEVF, KIAA0645 |
|---|
| Gene, Accession # | DEPDC5, Gene ID: 9681, Accession: O75140, SwissProt: O75140 |
|---|
| Catalog # | NBP2-30484 |
|---|
| Price | |
|---|
| Order / More Info | DEP Domain Containing 5 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|