| 产品详情 |
| Edit |   |
| Antigenic Specificity | DEPP1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. Use in WB reported in scientific literature (PMID 28545464). |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The DEPP1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to DEPP1. This antibody reacts with human. The DEPP1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human C10orf10 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: PSPSLDDYVRSISRLAQPTSVLDKATAQGQPRPPHRPAQACRKGRPAVSLRDITARFSGQQPTLPMADTVDP |
| Other Names | C10orf10, chromosome 10 open reading frame 10, Decidual protein induced by progesterone, DEPP, fasting induced, Fasting-induced gene protein, fasting-induced protein, FIG, protein DEPP |
| Gene, Accession # | C10ORF10, Gene ID: 11067, Accession: Q9NTK1, SwissProt: Q9NTK1 |
| Catalog # | NBP2-38367 |
| Price | |
| Order / More Info | DEPP1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 28545464 |
| 产品资料 |
|
|