| 产品详情 |
| Edit |   |
| Antigenic Specificity | DEPTOR/DEPDC6 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The DEPTOR/DEPDC6 Antibody from Novus Biologicals is a rabbit polyclonal antibody to DEPTOR/DEPDC6. This antibody reacts with human, mouse, rat. The DEPTOR/DEPDC6 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human, mouse, rat DEPTOR/DEPDC6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LVTGEQLRLRLHEEKVIKDRRHHLKTYPNCFVAKELIDWLIEHKEASDRETAIKLMQKLADRGIIHHVCDEH |
| Other Names | DEP domain containing 6, DEP domain containing mTOR interacting protein, DEP domain containing MTOR-interacting protein, DEP domain-containing mTOR-interacting protein, DEP domain-containing protein 6, DEP.6, DEPDC6FLJ12341, DKFZp564B1778, FLJ12428, FLJ13854 |
| Gene, Accession # | DEPTOR, Gene ID: 64798 |
| Catalog # | NBP1-85256 |
| Price | |
| Order / More Info | DEPTOR/DEPDC6 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|