| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | GCNT7 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The GCNT7 Antibody from Novus Biologicals is a rabbit polyclonal antibody to GCNT7. This antibody reacts with human. The GCNT7 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human GCNT7 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: TNREIIHYIRSKWSDKNITPGVIQPLHIKSKTSQSHLEFVPKGSIYAPPNNRFKDKPP |
|---|
| Other Names | beta-1,3-galactosyl-O-glycosyl-glycoproteinbeta-1,6-N-acetylglucosaminyltransferase 7, C20orf105, chromosome 20 open reading frame 105, dJ1153D9.2, EC 2.4.1, EC 2.4.1.-, EC 2.4.1.150, glucosaminyl (N-acetyl) transferase family member 7 |
|---|
| Gene, Accession # | GCNT7, Gene ID: 140687 |
|---|
| Catalog # | NBP2-49055 |
|---|
| Price | |
|---|
| Order / More Info | GCNT7 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|