| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | GDF-6/BMP-13 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The GDF-6/BMP-13 Antibody from Novus Biologicals is a rabbit polyclonal antibody to GDF-6/BMP-13. This antibody reacts with human. The GDF-6/BMP-13 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human GDF-6/BMP-13 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: IYRTYSIAEKLGINASFFQSSKSANTITSFVDRGLDDLSHTPLRRQKYLFDVSMLSDKEELVGAELRLFRQAPSAPWGPPAGPLHVQLF |
|---|
| Other Names | BMP13, CDMP2, GDF16, GDF-6, growth differentiation factor 6, Growth/differentiation factor 16, growth/differentiation factor 6, KFS, KFS1, KFSL, MCOP4, MCOPCB6, MGC158100, MGC158101, SCDO4, SGM1 |
|---|
| Gene, Accession # | GDF6, Gene ID: 392255 |
|---|
| Catalog # | NBP1-91934 |
|---|
| Price | |
|---|
| Order / More Info | GDF-6/BMP-13 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|