| Edit |   |
|---|
| Antigenic Specificity | GDF-8/Myostatin |
|---|
| Clone | 2D8 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The GDF-8/Myostatin Antibody (2D8) from Novus Biologicals is a mouse monoclonal antibody to GDF-8/Myostatin. This antibody reacts with human. The GDF-8/Myostatin Antibody (2D8) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | GDF8 (NP_005250 241 a.a. - 310 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GPGEDGLNPFLEVKVTDTPKRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCS |
|---|
| Other Names | GDF-8, GDF8growth differentiation factor 8, growth/differentiation factor 8, Myostatin |
|---|
| Gene, Accession # | MSTN, Gene ID: 2660, Accession: NP_005250, SwissProt: NP_005250 |
|---|
| Catalog # | H00002660-M06 |
|---|
| Price | |
|---|
| Order / More Info | GDF-8/Myostatin Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|