| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | RASA3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The RASA3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RASA3. This antibody reacts with human. The RASA3 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human RASA3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LFNLYMSKLEKMQEACGSKSVYDGPEQEEYSTFVIDDPQETYKTLKQVIAGVGALEQEHAQYKRDKFKKTKYGSQE |
|---|
| Other Names | GAP1(IP4BP), GAP1IP4BP, GAPIII, GTPase activating protein III, inositol 13,4,5-tetrakisphosphate-binding protein, Ins P4-binding protein, Ins(13,4,5)P4-binding protein, MGC46517, MGC47588, ras GTPase-activating protein 3, RAS p21 protein activator 3 |
|---|
| Gene, Accession # | RASA3, Gene ID: 22821 |
|---|
| Catalog # | NBP1-92316 |
|---|
| Price | |
|---|
| Order / More Info | RASA3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|