| Edit |   |
| Antigenic Specificity | TBCK |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The TBCK Antibody from Novus Biologicals is a rabbit polyclonal antibody to TBCK. This antibody reacts with human. The TBCK Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to MGC16169 The peptide sequence was selected from the middle region of MGC16169. Peptide sequence PPICTLPNFLFEDGESFGQGRDRSSLLDDTTVTLSLCQLRNRLKDVGGEA. |
| Other Names | HSPC302, MGC16169, TBC domain-containing protein kinase-like protein, TBC1 domain containing kinase, TBCKL |
| Gene, Accession # | TBCK, Gene ID: 93627, Accession: Q8TEA7-3, SwissProt: Q8TEA7-3 |
| Catalog # | NBP1-56343-20ul |
| Price | |
| Order / More Info | TBCK Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |