| Edit |   |
|---|
| Antigenic Specificity | TBCK |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TBCK Antibody from Novus Biologicals is a rabbit polyclonal antibody to TBCK. This antibody reacts with human. The TBCK Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to MGC16169 The peptide sequence was selected from the middle region of MGC16169. Peptide sequence PPICTLPNFLFEDGESFGQGRDRSSLLDDTTVTLSLCQLRNRLKDVGGEA. |
|---|
| Other Names | HSPC302, MGC16169, TBC domain-containing protein kinase-like protein, TBC1 domain containing kinase, TBCKL |
|---|
| Gene, Accession # | TBCK, Gene ID: 93627, Accession: Q8TEA7-3, SwissProt: Q8TEA7-3 |
|---|
| Catalog # | NBP1-56343 |
|---|
| Price | |
|---|
| Order / More Info | TBCK Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|