| Edit |   |
| Antigenic Specificity | LONRF3 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The LONRF3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to LONRF3. This antibody reacts with human. The LONRF3 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human LONRF3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LMDPAKVKGDGQQHHMKDQEEEEEKWDATSPKAASSKTGKCQEKKRKHCQIESQEETGMPNKASKQDPPTDQGDKPALSLPLASFDASDL |
| Other Names | LON peptidase N-terminal domain and ring finger 3, LON peptidase N-terminal domain and RING finger protein 3, MGC119463, MGC119465, RING finger protein 127FLJ22612, RNF127 |
| Gene, Accession # | LONRF3, Gene ID: 79836 |
| Catalog # | NBP2-47391 |
| Price | |
| Order / More Info | LONRF3 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |