| Edit |   |
| Antigenic Specificity | BEND7 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The BEND7 Antibody from Novus Biologicals is a rabbit polyclonal antibody to BEND7. This antibody reacts with human. The BEND7 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to BEND7 (BEN domain containing 7) The peptide sequence was selected from the middle region of BEND7. Peptide sequence LGFGIVLESPSSDPEVQLAEGFDVFMPKSQLDSILSNYTRSGSLLFRKLV. |
| Other Names | BEN domain containing 7, C10orf30 |
| Gene, Accession # | BEND7, Gene ID: 222389 |
| Catalog # | NBP1-70420-20ul |
| Price | |
| Order / More Info | BEND7 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |