| Edit |   |
|---|
| Antigenic Specificity | Angiopoietin-like Protein 2/ANGPTL2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Angiopoietin-like Protein 2/ANGPTL2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Angiopoietin-like Protein 2/ANGPTL2. This antibody reacts with human. The Angiopoietin-like Protein 2/ANGPTL2 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Angiopoietin-like Protein 2/ANGPTL2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: QEDGFEGTEEGSPREFIYLNRYKRAGESQDKCTYTFIVPQQRVTGAICVNSKEPEVLLENRVHKQELELLNNELLKQKRQIE |
|---|
| Other Names | angiopoietin-like 2, Angiopoietin-like protein 2, angiopoietin-related protein 2, ARP2HARP, MGC8889 |
|---|
| Gene, Accession # | ANGPTL2, Gene ID: 23452, Accession: Q9UKU9, SwissProt: Q9UKU9 |
|---|
| Catalog # | NBP1-88997 |
|---|
| Price | |
|---|
| Order / More Info | Angiopoietin-like Protein 2/ANGPTL2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 22357923 |
|---|