| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CD81 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CD81 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CD81. This antibody reacts with human. The CD81 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human CD81 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: VNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKLYL |
|---|
| Other Names | CD81 antigen, CD81 antigen (target of antiproliferative 1), CD81 molecule, CVID6, TAPA1, TAPA-1, Target of the antiproliferative 1, Tetraspanin-28, Tspan-28, tspan-28,26 kDa cell surface protein TAPA-1, TSPAN28S5.7 |
|---|
| Gene, Accession # | CD81, Gene ID: 975, Accession: P60033, P60033, P60033, P60033 |
|---|
| Catalog # | NBP1-80701 |
|---|
| Price | |
|---|
| Order / More Info | CD81 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|