| Edit |   |
|---|
| Antigenic Specificity | DPH1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human (antigen sequence identity: mouse 92%, rat 92%) |
|---|
| Isotype | n/a |
|---|
| Format | antigen affinity purified |
|---|
| Size | 100 µl |
|---|
| Concentration | n/a |
|---|
| Applications | ICC-IF |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit anti-human DPH1 polyclonal antibody. |
|---|
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: EAVVYLGDGRFHLESVMIANPNVPAYRYDPYSKVLSREHYDHQRMQAARQEAIATARSAK |
|---|
| Other Names | diphthamide biosynthesis 1, DPH2L, DPH2L1, OVCA1 |
|---|
| Gene, Accession # | Gene ID: 1801, UniProt: Q9BZG8, ENSG00000108963 |
|---|
| Catalog # | HPA069750 |
|---|
| Price | |
|---|
| Order / More Info | DPH1 Antibody from ATLAS ANTIBODIES AB |
|---|
| Product Specific References | n/a |
|---|